PRKX Rabbit Polyclonal Antibody

CAT#: TA342239

Rabbit polyclonal Anti-PRKX Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of protein kinase, X-linked (PRKX)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human protein kinase, X-linked (PRKX), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human protein kinase, X-linked (PRKX), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 41 kDa
Gene Name protein kinase, X-linked
Background This gene encodes a serine threonine protein kinase that has similarity toThe catalytic subunit of cyclic AMP dependent protein kinases.The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination betweenThis gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes ofThis gene are found on chromosomes X, 15 and Y. [provided by RefSeq, Feb 2010]
Synonyms PKX1
Note Immunogen Sequence Homology: Human: 100%; Rat: 75%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...