PRKX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	protein kinase, X-linked
Database Link	NP_005035 Entrez Gene 5613 Human UniProt ID P51817
Background	This gene encodes a serine threonine protein kinase that has similarity toThe catalytic subunit of cyclic AMP dependent protein kinases.The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination betweenThis gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes ofThis gene are found on chromosomes X, 15 and Y. [provided by RefSeq, Feb 2010]
Synonyms	PKX1
Note	Immunogen Sequence Homology: Human: 100%; Rat: 75%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.