PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	phosphatidylinositol-5-phosphate 4-kinase type 2 alpha
Database Link	NP_005019 Entrez Gene 5305 Human UniProt ID P48426
Background	Phosphatidylinositol-5,4-bisphosphate,The precursor to second messengers ofThe phosphoinositide signal transduction pathways, is thought to be involved inThe regulation of secretion, cell proliferation, differentiation, and motility.The protein encoded byThis gene is one of a family of enzymes capable of catalyzingThe phosphorylation of phosphatidylinositol-5-phosphate onThe fourth hydroxyl ofThe myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate.The amino acid sequence ofThis enzyme does not show homology to other kinases, butThe recombinant protein does exhibit kinase activity.This gene is a member ofThe phosphatidylinositol-5-phosphate 4-kinase family. [provided by RefSeq, Jul 2008]
Synonyms	PI5P4KA; PIP5K2A; PIP5KII-alpha; PIP5KIIA; PIPK
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Inositol phosphate metabolism, Phosphatidylinositol signaling system, Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.