RAB27A Rabbit Polyclonal Antibody

CAT#: TA342222

Rabbit polyclonal Anti-RAB27A Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human RAB27A, member RAS oncogene family (RAB27A), transcript variant 2, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 2
    • 100 ug

CN¥ 3,080.00


Purified recombinant protein of Homo sapiens RAB27A, member RAS oncogene family (RAB27A), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00


Transient overexpression lysate of RAB27A, member RAS oncogene family (RAB27A), transcript variant 1
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name RAB27A, member RAS oncogene family
Background The protein encoded byThis gene belongs toThe small GTPase superfamily, Rab family.The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations inThis gene are associated with Griscelli syndrome type 2. Alternative splicing occurs atThis locus and four transcript variants encodingThe same protein have been identified. [provided by RefSeq, Jul 2008]
Synonyms GS2; HsT18676; RAB27; RAM
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Goat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...