Sh3gl3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sh3gl3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	SH3-domain GRB2-like 3
Database Link	NP_059096 Entrez Gene 20408 Mouse UniProt ID Q62421
Background	Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
Synonyms	CNSA3; EEN-2B-L3; EEN-B2; Endophilin-3; HsT19371; SH3D2C; SH3P13
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.