Sterol carrier protein 2 (SCP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SCP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SCP2. Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	sterol carrier protein 2
Database Link	NP_001180529 Entrez Gene 6342 Human UniProt ID P22307
Background	This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters.The transcript initiated fromThe proximal promoter encodesThe longer SCPx protein, andThe transcript initiated fromThe distal promoter encodesThe shorter SCP2 protein, withThe 2 proteins sharing a common C-terminus. Evidence suggests thatThe SCPx protein is a peroxisome-associated thiolase that is involved inThe oxidation of branched chain fatty acids, whileThe SCP2 protein is thought to be an intracellular lipid transfer protein.This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing ofThis gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq, Aug 2010]
Synonyms	NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79%
Reference Data
Protein Pathways	Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.