RALB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RALB antibody: synthetic peptide directed towards the middle region of human RALB. Synthetic peptide located within the following region: FREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	RALB Ras like proto-oncogene B
Database Link	NP_002872 Entrez Gene 5899 Human UniProt ID P11234
Background	This gene encodes a GTP-binding protein that belongs toThe small GTPase superfamily and Ras family of proteins. GTP-binding proteins mediateThe transmembrane signaling initiated byThe occupancy of certain cell surface receptors. [provided by RefSeq, Jul 2008]
Synonyms	GTP binding protein; GTP binding protein); RAS-like protein B; v-ral simian leukemia viral oncogene homolog B; v-ral simian leukemia viral oncogene homolog B (ras related
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Pancreatic cancer, Pathways in cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.