PRSS8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRSS8 antibody: synthetic peptide directed towards the middle region of human PRSS8. Synthetic peptide located within the following region: PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	protease, serine 8
Database Link	NP_002764 Entrez Gene 5652 Human UniProt ID Q16651
Background	This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid.The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine. [provided by RefSeq, Jul 2008]
Synonyms	CAP1; PROSTASIN
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.