PKC iota (PRKCI) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	protein kinase C iota
Database Link	NP_002731 Entrez Gene 5584 Human UniProt ID P41743
Background	This gene encodes a member ofThe protein kinase C (PKC) family of serine/threonine protein kinases.The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes.This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol.This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction withThe small GTPase RAB2, whereThis kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics inThe early secretory pathway.This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis andTherefore protects leukemia cells against drug-induced apoptosis.There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]
Synonyms	DXS1179E; nPKC-iota; PKCI
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Protein Kinase
Protein Pathways	Endocytosis, Insulin signaling pathway, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.