HIPK1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HIPK1 antibody: synthetic peptide directed towards the middle region of human HIPK1. Synthetic peptide located within the following region: PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	131 kDa
Gene Name	homeodomain interacting protein kinase 1
Database Link	NP_938010 Entrez Gene 204851 Human UniProt ID Q86Z02
Background	The protein encoded byThis gene belongs toThe Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008]
Synonyms	Myak; Nbak2
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome, Protein Kinase, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.