OSGIN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OSGIN1 antibody: synthetic peptide directed towards the N terminal of human OSGIN1. Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	oxidative stress induced growth inhibitor 1
Database Link	NP_892026 Entrez Gene 29948 Human UniProt ID Q9UJX0
Background	This gene encodes an oxidative stress response protein that regulates cell death. Expression ofThe gene is regulated by p53 and is induced by DNA damage.The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules.The loss ofThis protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists betweenThis gene andThe neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, butThe read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011]
Synonyms	BDGI; OKL38
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.