ZNF658B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF658B antibody is: synthetic peptide directed towards the middle region of Human ZNF658B. Synthetic peptide located within the following region: IECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSHKTHLSVHQRVHTG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	zinc finger protein 658B (pseudogene)
Database Link	NP_001027468 Entrez Gene 401509 Human
Background	ZNF658B may be involved in transcriptional regulation.
Synonyms	zinc finger protein 658B
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%; Zebrafish: 92%; Guinea pig: 92%; Dog: 86%; Yeast: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.