MOGT1 (MOGAT1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1. Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	monoacylglycerol O-acyltransferase 1
Database Link	NP_477513 Entrez Gene 116255 Human UniProt ID Q96PD6
Background	Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzesThe synthesis of diacylglycerols,The precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzesThe synthesis of diacylglycerols,The precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093
Synonyms	DGAT2L; DGAT2L1; MGAT1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Dog: 92%; Rat: 86%; Guinea pig: 86%; Horse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.