Galnt13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Galnt13 antibody is: synthetic peptide directed towards the C-terminal region of Rat Galnt13. Synthetic peptide located within the following region: EFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	polypeptide N-acetylgalactosaminyltransferase 13
Database Link	NP_954537 Entrez Gene 311039 Rat UniProt ID Q6UE39
Background	Human homolog is a member of a family of proteins which catalyzeThe transfer of N-acetyl-alpha-d-galactosamine to polypeptides such as mucin which initiates O-Linked glycosylation.
Synonyms	FLJ16031; FLJ41157; GalNAc-T13; H_NH0187G20.1; KIAA1918; MGC119459; MGC119461; WUGSC:H_NH0187G20.1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.