MMEL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MMEL1 antibody: synthetic peptide directed towards the middle region of human MMEL1. Synthetic peptide located within the following region: EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	membrane metallo-endopeptidase-like 1
Database Link	NP_258428 Entrez Gene 79258 Human UniProt ID Q495T6
Background	MMEL1 is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis. MMEL1 is a type II transmembrane protein and is thought to be expressed as a secreted protein.The protein encoded byThis gene is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.This protein is a type II transmembrane protein and is thought to be expressed as a secreted protein.This gene is expressed mainly in testis with weak expression inThe brain, kidney, and heart.
Synonyms	MMEL2; NEP2; NEPII; NL1; NL2; SEP
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Protease, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.