C8orf55 (THEM6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-4930572J05Rik antibody is: synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik. Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	thioesterase superfamily member 6
Database Link	NP_057731 Entrez Gene 223626 Mouse UniProt ID Q8WUY1
Background	The function ofThis protein remains unknown.
Synonyms	C8orf55; DSCD75
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.