C19orf56 (WDR83OS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C19orf56 antibody: synthetic peptide directed towards the N terminal of human C19orf56. Synthetic peptide located within the following region: STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	WD repeat domain 83 opposite strand
Database Link	NP_057229 Entrez Gene 51398 Human UniProt ID Q9Y284
Background	The exact function of C19orf56 remains unknown.
Synonyms	C19orf56; PTD008
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.