TMX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tmx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Tmx2. Synthetic peptide located within the following region: IRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	thioredoxin related transmembrane protein 2
Database Link	NP_057043 Entrez Gene 66958 Mouse UniProt ID Q9Y320
Background	The function ofThis protein remains unknown.
Synonyms	CGI-31; PDIA12; PIG26; TXNDC14
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.