PIGT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PIGT antibody: synthetic peptide directed towards the N terminal of human PIGT. Synthetic peptide located within the following region: PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	phosphatidylinositol glycan anchor biosynthesis class T
Database Link	NP_057021 Entrez Gene 51604 Human UniProt ID Q969N2
Background	This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins toThe cell surface.This protein is an essential component ofThe multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring inThe endoplasmic reticulum, by catalyzingThe transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, May 2012]
Synonyms	CGI-06; MCAHS3; NDAP; PNH2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.