CHST15 Rabbit Polyclonal Antibody

CAT#: TA341985

Rabbit Polyclonal Anti-GALNAC4S-6ST Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 (CHST15)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human B cell RAG associated protein (GALNAC4S-6ST), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human B cell RAG associated protein (GALNAC4S-6ST), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GALNAC4S-6ST antibody: synthetic peptide directed towards the middle region of human GALNAC4S-6ST. Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 65 kDa
Gene Name carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
Background Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component ofThe extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in whichThe C-4 and C-6 hydroxyl groups are sulfated.This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate toThe C-6 hydroxal group of chondroitin sulfate.This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]
Synonyms BRAG; GALNAC4S-6ST
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Chondroitin sulfate biosynthesis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...