CYP2A7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM158 antibody: synthetic peptide directed towards the middle region of human TMEM158. Synthetic peptide located within the following region: AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	cytochrome P450 family 2 subfamily A member 7
Database Link	NP_000755 Entrez Gene 1549 Human UniProt ID P20853
Background	Constitutive activation ofThe Ras pathway triggers an irreversible proliferation arrest reminiscent of replicative senescence. Transcription ofThis gene is upregulated in response to activation ofThe Ras pathway, but not under other conditions that induce senescence.The encoded protein is similar to a rat cell surface receptor proposed to function in a neuronal survival pathway. [provided by RefSeq, Jul 2008]
Synonyms	CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%
Reference Data
Protein Families	Druggable Genome, P450, Transmembrane
Protein Pathways	Caffeine metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Retinol metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.