KIAA0319 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA0319 antibody: synthetic peptide directed towards the N terminal of human KIAA0319. Synthetic peptide located within the following region: EEMSEYSDDYRELEKDLLQPSGKQEPRGSAEYTDWGLLPGSEGAFNSSVG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	KIAA0319
Database Link	NP_001161846 Entrez Gene 9856 Human UniProt ID Q5VV43
Background	This gene encodes a transmembrane protein that contains a large extracellular domain with multiple polycystic kidney disease (PKD) domains.The encoded protein may play a role inThe development ofThe cerebral cortex by regulating neuronal migration and cell adhesion. Single nucleotide polymorphisms inThis gene are associated with dyslexia. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2011]
Synonyms	DYLX2; DYX2; NMIG
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 86%; Bovine: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.