MICS1 (GHITM) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ghitm antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	growth hormone inducible transmembrane protein
Database Link	NP_055209 Entrez Gene 66092 Mouse UniProt ID Q9H3K2
Background	Required forThe mitochondrial tubular network and cristae organization. Involved in apoptotic release of cytochrome c.
Synonyms	DERP2; HSPC282; MICS1; My021; PTD010; TMBIM5
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Goat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.