ASTN2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASTN2 antibody: synthetic peptide directed towards the N terminal of human ASTN2. Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	142 kDa
Gene Name	astrotactin 2
Database Link	NP_054729 Entrez Gene 23245 Human UniProt ID O75129
Background	This gene encodes a protein that is expressed inThe brain and may function in neuronal migration, based on functional studies ofThe related astrotactin 1 gene in human and mouse. A deletion atThis locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found forThis locus. [provided by RefSeq, May 2010]
Synonyms	bA67K19.1
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.