PILRB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	paired immunoglobin-like type 2 receptor beta
Database Link	NP_038468 Entrez Gene 29990 Human UniProt ID Q9UKJ0
Background	The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved inThe regulation of many aspects ofThe immune system.The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This gene encodesThe activating member ofThe receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs.This gene is thought to have arisen from a duplication ofThe inhibitory PILRA gene and evolved to acquire its activating function. [provided by RefSeq, Jun 2013]
Synonyms	FDFACT1; FDFACT2
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.