NNT Rabbit Polyclonal Antibody

CAT#: TA341910

Rabbit Polyclonal Anti-NNT Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of nicotinamide nucleotide transhydrogenase (NNT), nuclear gene encoding mitochondrial protein, transcript variant 1
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 114 kDa
Gene Name nicotinamide nucleotide transhydrogenase
Background This gene encodes an integral protein ofThe inner mitochondrial membrane.The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation acrossThe inner mitochondrial membrane. Under most physiological conditions,The enzyme uses energy fromThe mitochondrial proton gradient to produce high concentrations of NADPH.The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encodingThe same protein, have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms GCCD4
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...