NNT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	114 kDa
Gene Name	nicotinamide nucleotide transhydrogenase
Database Link	NP_036475 Entrez Gene 23530 Human UniProt ID Q13423
Background	This gene encodes an integral protein ofThe inner mitochondrial membrane.The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation acrossThe inner mitochondrial membrane. Under most physiological conditions,The enzyme uses energy fromThe mitochondrial proton gradient to produce high concentrations of NADPH.The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encodingThe same protein, have been found forThis gene. [provided by RefSeq, Jul 2008]
Synonyms	GCCD4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Nicotinate and nicotinamide metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.