B3GAT3 Rabbit Polyclonal Antibody

CAT#: TA341900

Rabbit Polyclonal Anti-B3GAT3 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (B3GAT3), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 37 kDa
Gene Name beta-1,3-glucuronyltransferase 3
Background The protein encoded byThis gene is a member ofThe glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars andTheir anomeric linkages.This gene product catalyzesThe formation ofThe glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction inThe final step ofThe biosynthesis ofThe linkage region of proteoglycans. A pseudogene ofThis gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013]
Synonyms GLCATI; glcUAT-I; JDSCD
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Guinea pig: 93%
Reference Data
Protein Families Transmembrane
Protein Pathways Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...