FKBP38 (FKBP8) Rabbit Polyclonal Antibody

CAT#: TA341899

Rabbit Polyclonal Anti-FKBP8 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of FK506 binding protein 8, 38kDa (FKBP8)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the C terminal of human FKBP8. Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name FK506 binding protein 8
Background The protein encoded byThis gene is a member ofThe immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. UnlikeThe other members ofThe family,This encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. [provided by RefSeq, Jul 2008]
Synonyms FKBP38; FKBPr38
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...