BACE2 Rabbit Polyclonal Antibody
CAT#: TA341893
Rabbit Polyclonal Anti-BACE2 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 3,080.00
CN¥ 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | beta-site APP-cleaving enzyme 2 |
Database Link | |
Background | This gene encodes an integral membrane glycoprotein that functions as an aspartic protease.The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step inThe etiology of Alzheimer's disease and Down syndrome.The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Synonyms | AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |