NOX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	NADPH oxidase 1
Database Link	NP_008983 Entrez Gene 27035 Human UniProt ID Q9Y5S8
Background	This gene encodes a member ofThe NADPH oxidase family of enzymes responsible forThe catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Nov 2012]
Synonyms	GP91-2; MOX1; NOH-1; NOH1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Other, Transmembrane
Protein Pathways	Leukocyte transendothelial migration

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.