TMED1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1. Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	transmembrane p24 trafficking protein 1
Database Link	NP_006849 Entrez Gene 11018 Human UniProt ID Q13445
Background	This gene belongs toThe TMED (transmembrane emp24 domain-containing) protein family, which is involved inThe vesicular trafficking of proteins.The protein encoded byThis gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity.This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants ofThis gene. [provided by RefSeq, Jul 2013]
Synonyms	Il1rl1l; IL1RL1LG; p24g1; Tp24
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.