LYVE1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LYVE1 antibody: synthetic peptide directed towards the N terminal of human LYVE1. Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	lymphatic vessel endothelial hyaluronan receptor 1
Database Link	NP_006682 Entrez Gene 10894 Human UniProt ID Q9Y5Y7
Background	This gene encodes a type I integral membrane glycoprotein.The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan.This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provided by RefSeq, Jul 2008]
Synonyms	CRSBP-1; HAR; LYVE-1; XLKD1
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Dog: 79%; Guinea pig: 79%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.