PGRMC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	progesterone receptor membrane component 1
Database Link	NP_006658 Entrez Gene 10857 Human UniProt ID O00264
Background	This gene encodes a putative membrane-associated progesterone steroid receptor.The protein is expressed predominantly inThe liver and kidney. [provided by RefSeq, Mar 2010]
Synonyms	HPR6.6; MPR
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.