Camk4 Rabbit Polyclonal Antibody
CAT#: TA341837
Rabbit Polyclonal Anti-CAMK4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,537.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CAMK4 antibody: synthetic peptide directed towards the C terminal of mouse CAMK4. Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | calcium/calmodulin-dependent protein kinase IV |
Database Link | |
Background | CAMK4 plays key roles inThe function and development ofThe cerebellu |
Synonyms | CaMK-GR; MGC36771 |
Note | Immunogen Sequence Homology: Mouse: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |