Camk4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CAMK4 antibody: synthetic peptide directed towards the C terminal of mouse CAMK4. Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	calcium/calmodulin-dependent protein kinase IV
Database Link	NP_033923 Entrez Gene 814 Human
Background	CAMK4 plays key roles inThe function and development ofThe cerebellu
Synonyms	CaMK-GR; MGC36771
Note	Immunogen Sequence Homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.