SMYD1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMYD1 antibody: synthetic peptide directed towards the N terminal of mouse SMYD1. Synthetic peptide located within the following region: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	SET and MYND domain containing 1
Database Link	NP_938015 Entrez Gene 12180 Mouse UniProt ID Q8NB12
Background	SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation
Synonyms	BOP; KMT3D; ZMYND18; ZMYND22
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Human: 93%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.