TAL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	T-cell acute lymphocytic leukemia 2
Database Link	NP_005412 Entrez Gene 21350 Mouse UniProt ID Q16559
Background	The function ofThis protein remains unknown.
Synonyms	bHLHa19; T-cell acute lymphocytic leukemia 2
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 93%; Bovine: 93%; Dog: 86%; Horse: 79%; Rabbit: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.