Sin3b Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sin3b antibody: synthetic peptide directed towards the N terminal of mouse Sin3b. Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	105 kDa
Gene Name	transcriptional regulator, SIN3B (yeast)
Database Link	NP_033214 Entrez Gene 23309 HumanEntrez Gene 20467 Mouse UniProt ID Q62141
Background	Sin3B is one ofThe Sin3 co-repressors act as a protein scaffold to recruit transcription factors via its four highly homologous paired amphipathic helix (PAH) domains.
Synonyms	KIAA0700
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.