Neo1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Neo1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Neo1. Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	163 kDa
Gene Name	neogenin
Database Link	NP_032710 Entrez Gene 18007 Mouse
Background	The function ofThis protein remains unknown.
Synonyms	DKFZp547A066; DKFZp547B146; HsT17534; IGDCC2; NGN
Note	Immunogen Sequence Homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.