Hoxb13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HOXB13 antibody: synthetic peptide directed towards the middle region of mouse HOXB13. Synthetic peptide located within the following region: GYFGGGYYSCRVSRSSLKPCAQTAALATYPSETPAPGEEYPSRPTEFAFY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	homeobox B13
Database Link	NP_032293 Entrez Gene 10481 Human UniProt ID P70321
Background	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities onThe anterior-posterior axis.
Synonyms	PSGD
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 79%; Horse: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.