HOXB13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Hoxb13 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb13. Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	homeobox B13
Database Link	NP_006352 Entrez Gene 15408 Mouse UniProt ID Q92826
Background	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities onThe anterior-posterior axis.
Synonyms	PSGD
Note	Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Pig: 85%; Guinea pig: 85%; Human: 79%; Rabbit: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.