EHF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ehf antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	ETS homologous factor
Database Link	NP_036285 Entrez Gene 13661 MouseEntrez Gene 26298 Human UniProt ID Q9NZC4
Background	Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation.Ehf may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator ofThe nuclear response to mitogen-activated protein kinase signaling cascades.Ehf binds to DNA sequences containingThe consensus nucleotide core sequence GGAA.Ehf is involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences onThe TNFRSF10B/DR5 promoter.
Synonyms	ESE3; ESE3B; ESEJ
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Human: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.