Ciita Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C2TA antibody: synthetic peptide directed towards the C terminal of mouse C2TA. Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	119 kDa
Gene Name	class II transactivator
Database Link	NP_031601 Entrez Gene 12265 Mouse UniProt ID P79621
Background	Essential for transcriptional activity ofThe HLA class II promoter; activation is viaThe proximal promoter. No DNA binding of in vitro translated CIITA was detected. May act in a coactivator-like fashion through protein-protein interactions by contacting factors binding toThe proximal MHC class II promoter, to elements ofThe transcription machinery, or both. Alternatively it may activate HLA class II transcription by modifying proteins that bind toThe MHC class II promoter. Also mediates enhanced MHC class I transcription,The promoter element requirements for CIITA-mediated transcription are distinct from those of constitutive MHC class I transcription, and CIITA can functionally replace TAF1 atThese genes. Exhibits intrinsic GTP-stimulated acetyltransferase activity. Exhibits serine/threonine protein kinase activity: phosphorylatesThe TFIID component TAF7,The RAP74 subunit ofThe general transcription factor TFIIF, histone H2B at 'Ser-37' and other histones.
Synonyms	C2TA; CIITAIV; MHC2TA; NLRA
Note	Immunogen Sequence Homology: Dog: 100%; Mouse: 100%; Rat: 93%; Human: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.