Arntl Rabbit Polyclonal Antibody
CAT#: TA341745
Rabbit Polyclonal Anti-Arntl Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 7,106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Arntl antibody is: synthetic peptide directed towards the C-terminal region of Mouse Arntl. Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 69 kDa |
Gene Name | aryl hydrocarbon receptor nuclear translocator-like |
Database Link | |
Background | The protein encoded byThis gene is a basic helix-loop-helix protein that forms a heterodimer with Clock.This heterodimer binds E-box enhancer elements upstream of Period (Per1, Per2, Per3) and Cryptochrome (Cry1, Cry2) genes and activates transcription ofThese genes. Per and Cry proteins heterodimerize and repressTheir own transcription by interacting in a feedback loop with Clock/Arntl complexes. Defects inThis gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2014] |
Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MGC47515; MOP3; PASD3; TIC |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 87% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |