KCTD11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	potassium channel tetramerization domain containing 11
Database Link	NP_001002914 Entrez Gene 147040 Human UniProt ID Q693B1
Background	The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation ofThe tumor-promoting Hedgehog pathway in medulloblastoma.
Synonyms	C17orf36; KCASH1; KCTD11; REN
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 90%
Reference Data
Protein Families	Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.