TRPM3 Rabbit Polyclonal Antibody
CAT#: TA341729
Rabbit Polyclonal Anti-TRPM3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | transient receptor potential cation channel subfamily M member 3 |
Database Link | |
Background | The product ofThis gene belongs toThe family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis.The protein encoded byThis gene mediates calcium entry, andThis entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Synonyms | GON-2; LTRPC3; MLSN2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |