KCNK6 Rabbit Polyclonal Antibody

CAT#: TA341716

Rabbit Polyclonal Anti-KCNK6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of potassium channel, subfamily K, member 6 (KCNK6)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human potassium channel, subfamily K, member 6 (KCNK6), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 34 kDa
Gene Name potassium two pore domain channel subfamily K member 6
Background This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]
Synonyms K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%
Reference Data
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...