GJD2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CX36 antibody: synthetic peptide directed towards the middle region of human CX36. Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	gap junction protein delta 2
Database Link	NP_065711 Entrez Gene 57369 Human UniProt ID Q9UKL4
Background	This gene encodes a member ofThe connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component ofThe gap junction intercellular channel.The channels formed byThis protein allow cationic molecule exchange between human beta cells and may function inThe regulation of insulin secretion. [provided by RefSeq, Oct 2012]
Synonyms	CX36; GJA9
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 88%; Pig: 88%; Rat: 88%; Horse: 88%; Mouse: 88%; Guinea pig: 88%; Rabbit: 86%
Reference Data
Protein Families	Ion Channels: Other, Transmembrane
Protein Pathways	Gap junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.