MCM5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	minichromosome maintenance complex component 5
Database Link	NP_006730 Entrez Gene 4174 Human UniProt ID P33992
Background	The protein encoded byThis gene is structurally very similar toThe CDC46 protein from S. cerevisiae, a protein involved inThe initiation of DNA replication.The encoded protein is a member ofThe MCM family of chromatin-binding proteins and can interact with at least two other members ofThis family.The encoded protein is upregulated inThe transition fromThe G0 to G1/S phase ofThe cell cycle and may actively participate in cell cycle regulation. [provided by RefSeq, Jul 2008]
Synonyms	CDC46; P1-CDC46
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Stem cell - Pluripotency, Transcription Factors
Protein Pathways	Cell cycle, DNA replication

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.