MCM7 Rabbit Polyclonal Antibody
CN¥ 4,537.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the N terminal of human MCM7. Synthetic peptide located within the following region: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | minichromosome maintenance complex component 7 |
Database Link | |
Background | The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed byThe MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate withThis protein, and may regulateThe binding ofThis protein withThe tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Synonyms | CDC47; MCM2; P1.1-MCM3; P1CDC47; P85MCM; PNAS146; PPP1R104 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%; Horse: 79%; Mouse: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Cell cycle, DNA replication |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |