GJB6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJB6 antibody: synthetic peptide directed towards the middle region of human GJB6. Synthetic peptide located within the following region: CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	gap junction protein beta 6
Database Link	NP_006774 Entrez Gene 10804 Human UniProt ID O95452
Background	Gap junctions allowThe transport of ions and metabolites betweenThe cytoplasm of adjacent cells.They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed betweenThe two inner transmembrane segments, andThe N- and C-terminus both being inThe cytoplasm.The specificity ofThe gap junction is determined by which connexin proteins compriseThe hemichannel. InThe past, connexin protein names were based onTheir molecular weight, howeverThe new nomenclature uses sequential numbers based on which form (alpha or beta) ofThe gap junction is present.This gene encodes one ofThe connexin proteins. Mutations inThis gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
Synonyms	CX30; DFNA3; DFNA3B; DFNB1B; ECTD2; ED2; EDH; HED; HED2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 85%; Goat: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.