Nucleobindin 2 (NUCB2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Mouse, Canine
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	nucleobindin 2
Database Link	NP_005004 Entrez Gene 53322 MouseEntrez Gene 4925 Human UniProt ID P80303
Background	This gene encodes a protein with a suggested role in calcium level maintenance, eating regulation inThe hypothalamus, and release of tumor necrosis factor from vascular endothelial cells.This protein binds calcium and has EF-folding domains. [provided by RefSeq, Oct 2011]
Synonyms	HEL-S-109; NEFA
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Yeast: 91%; Guinea pig: 86%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.